McDonnell Genome Institute

Washington University

CircRNA

chr17|61015750|61084564|+|BCAS3|ENST00000390652.9

Cancer

Type of Peptide

BRCA-Luminal B

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.977

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

10

Peptide

GVSTVIDAASGK

Amino Acids from 5' Exons

GNTAKTPITILPTTTLATLGSLLFPAWCLLHKSSSQHWGPSPNEP,ETEQPRLLQFYQQQPWQPSALSSSQLDGSDASCTNQAANDIGDHHQTNR,KLNSQDSYNNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGTITKRT

Amino Acids from 3' Exons

DPASPLPRQHARVIPSSLSKGSFHSDCCL,IQPVRSDPVSMPGSSRPVSDRRGVSTVIDAAS,SSQSALTPSACQGHPVQSLIEGEFPQLMLPQ