McDonnell Genome Institute

Washington University

CircRNA

chr17|60219627|60223586|-|USP32|ENST00000591768.1

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9996

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

2

Peptide

MFPQHLPR

Amino Acids from 5' Exons

VIKNSKTDIPELELFPRYLLFLRQQPATRTQQSNIWVNMGMMSLRMFPQHLPR,LSRTARQTSQSWNYFPAIFSSDSSLPLGHSSLTSGIWVAECFLSIYRE,YQEQQDRHPRAGIISPLSSLPETAACHSDTAVHLGEYGYDEPENVSSAFTE

Amino Acids from 3' Exons

AFCILPHQGQMFALLDNITLLTITTSVCWEPMGIFCCTLTLRNQGLLIISHLKNQ,LSVFCHTRGRCLLCSTTHFQQPVFAGSQWEYFVAPPSETRGYSAISNSRTSK,FLYSATPGADVCFARQHNTSDNNNQCLLGANGNILLHLNPQKPGAIDNQPLVTQEPVK