McDonnell Genome Institute

Washington University

CircRNA

chr17|60198259|60214774|-|USP32|ENST00000300896.8

Cancer

Type of Peptide

BRCA-HER2-enriched

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9822

20

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

7

Peptide

AGISLYR

Amino Acids from 5' Exons

MRTELYFLSSQKNRPSLFGMPLIVPCTVHTRKKDLYDAVWIQVSRLASPLPPQEASNHAQD,GQNCISCHLRRIAPASLECHLFHVLCIPGRKTYMMRFGFKYPGRAHSHLRKLVIMPRI,EDRTVFPVISEESPQPLWNAIDCSMYCAYPEERPICGLDSSIPVSEPTPTSGSSCPGL

Amino Acids from 3' Exons

EMYLLRMHLSGYPIQAVLVECRPSRKFTNIYLKGCALKRKICACGYTTV,KCTFSECTFKAGISLYRLFSNADHQGNSRISISKAAHRGRYAPVAIQQ,NVPSPNAPLKRVLAYTGCFSRMQTIKEIHEYLSQRLRIKEEDMRLWLYNSE