McDonnell Genome Institute

Washington University

CircRNA

chr17|59661442|59674843|+|CLTC|ENST00000269122.7

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9635

23

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

2

Peptide

VSQPSQVK

Amino Acids from 5' Exons

GILRTPDTIRRFQSVPAQPGQTSPLLQYFGILLDQGQLNKYESLELCRPVLQQGRKQLLEKWLKEDK,EFFVLQTLSVGSRVSQPSQVKLLLYFSTLVSFWTRDSSTNTNPSFVGLYFSKGENSFWRNGKKI,NSSYSRHYPSVPECPSPARSNFSSTSVLWYPFGPGTAQQIRILRALACTSARAKTAFGEMVKRR

Amino Acids from 3' Exons

VNPSRLPVVIGGLLDVDCSEDVIKNLILVVRGQFSTDELVAEVEKRN,IQVDFLLLEDYLMLTVLKMSKTFLLEVNSLLMSLLLRLKKET,ESKSTSCSYWRITCLFRCHKKLDSCCKRSILYACCGKKKQ