McDonnell Genome Institute

Washington University

CircRNA

chr17|59651202|59664909|+|CLTC|ENST00000269122.7

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

10

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

18

25

Peptide

ISPDQGQQFAQMLVQDEEPLADITQLHIIEVGTPPTGNQPFPK

Amino Acids from 5' Exons

LHIIEVGTPPTGNQPFPKKAVDVFFPPEAQNDFPVAMQ,YILLKLAHHLQGTSPFQRRQWMSSFLQKHKMIFLLQC,TYYSWHTTYREPALSKEGSGCLLSSRSTKFSCCNA

Amino Acids from 3' Exons

VGYTPDWIFLLRNVMRISPDQGQQFAQMLVQDEEPLADITQ,LDTLQIGYFCEMCESVQIRDSSLPKCFKMKSLLLTSH,WIHSRLDISAEKCNANQSRSGTAVCPNVSSRRASCHHT