McDonnell Genome Institute

Washington University

CircRNA

chr17|59644275|59651316|+|CLTC|ENST00000269122.7

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9355

23

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

22

2

Peptide

MQLQNLGINPANIGFSTLTMESDK

Amino Acids from 5' Exons

LQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMNDPSNPIRRPISADSAIMNPASKVIALK,SRTWVSTQQTLASVPLWSLTNSSALEKKESRPRWSLIMTQVIQFEDQFQQTAPSIQLAKLHK,PEPGYQPSKHWLQYPDYGVQIHLHRKSRRAGPGGNHYEPKSNSKTNFSRQRHHESSQSNCTE

Amino Acids from 3' Exons

LHIIEVGTPPTGNQPFPKKAVDVFFPPEAQNDFPVAMQ,YILLKLAHHLQGTSPFQRRQWMSSFLQKHKMIFLLQC,TYYSWHTTYREPALSKEGSGCLLSSRSTKFSCCNA