McDonnell Genome Institute

Washington University

CircRNA

chr17|59245413|59267174|+|GDPD1|ENST00000284116.8

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9763

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

13

Peptide

EQFFEIPMPSIILNAVK

Amino Acids from 5' Exons

CGNRNYARIGLPYHKRTSCSVTESKESNWGQCKHLSQIL,AVKIGTDMLELDCHITKDEQVVVSHDENLKRATGVNVNISDLKYC,RLKSELICNWTAISQKMNKLCHMMRIREQLGSMTSLISNT

Amino Acids from 3' Exons

NSDIPILFSLQRVLLILGLFFTGLLPFVPIREQFFEIPMPSIIL,IQIFLYSSVYNVSCSFLAFSSLASCPLCPFENSFLKSQCLLLY,FRYSYTLQSTTCPAHSWPFLHWPLALCAHSRTVFNPNAFYYTE