top of page

McDonnell Genome Institute

Washington University

CircRNA

chr17|58965693|58972925|+|PPM1E|ENST00000308249.3

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.94

73

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

2

Peptide

AIEIETVK

Amino Acids from 5' Exons

RLRQNWPVLSSANYTRFAAAGKTSPSAGDPSFIMRHQSMPSKTCAGKWRTNMSAFLTLICSST,DDSEIGPFCLQQTTRDLLQLGERLPPPQETPALLDINPCHQKHAQENGGQTCLHSLYALQPR,IETVKLARSVFSKLHEICCSWVKDFPLRRRPQLYYETSIHAIKNMRRKMEDKHVCIPDFNMLFNLE

Amino Acids from 3' Exons

DEKQRIEALGGCVVWFGAWRVNGSLSVSRAI,MKSRELRPLEVASGLVPGGMEVCRFPELL,KAENGPWRLRSLVWCLEGEWKSVGFQSY

bottom of page