McDonnell Genome Institute

Washington University

CircRNA

chr17|5388801|5404246|-|NUP88|ENST00000225696.8

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9843

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

2

Peptide

SVANPAFLNQK

Amino Acids from 5' Exons

KYSPSSVSSPALYSRRCSGRVSPPCSGNPRFLKAYKHFATCCQSSIFE,STVHPASPPLLCTREDVEVAESPLRVLAETPDSFEKHIRSILQRSVANPAFL,VQSIQRLLPCFVLEKMLKWQSLPSVFWLKPQIPLKSILEAFCNVVLPIQHF

Amino Acids from 3' Exons

SEKSWDSRIDLIPSLYVFECVELELALKLASGEDDPFDSDFSCPVKLHR,QKSPGIPGLTSFLLCMCLNVLSWSLLNWHLERMTLLILTFLVQSNFIE,RKVLGFQDPHSFSVCVMCVGACFETGIWRGPFFLFLSSQTS