McDonnell Genome Institute

Washington University

CircRNA

chr17|5373313|5377305|+|RABEP1|ENST00000341923.10

Cancer

Type of Peptide

BRCA-Basal-like

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.953

11

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

2

Peptide

AGEVTER

Amino Acids from 5' Exons

AVLMQSREQVSEELVRLQKDNDSLQGKHSLHVSLQQAEDFILPDTTE,RCCSHGNRFQKSWGYRKIMTVSRESTACMCHYSKQKTSSSQTLQ,GADAVTGTGFRRAGEVTERQSPGKAQPACVITASRRLHPPRHYR

Amino Acids from 3' Exons

ALRELVLKYREDIINVRTAADHVEEKLKAEILFLKEQIQAEQCLKENLEETLQLEIENCKEEI,HCGSWYNTVRTSLMCGQQQTTKKSRLRYFSKSRSKQNSVKKILKKLCNKKTARRK,TAGVGIKIPGHHCADSSRPRRRKAEGDTFPKRADPSRTVFKRKSRNSATRNRKLQGGN