McDonnell Genome Institute

Washington University

CircRNA

chr17|5331948|5332152|+|RABEP1|ENST00000341923.10

Cancer

Type of Peptide

BRCA-HER2-enriched

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9791

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

14

Peptide

QWREEVASLQAVMKEDLK

Amino Acids from 5' Exons

RIRGKMQYYKLHKMIWDTFEPSCGKLKQRWRILRRLPQSLRTPSKKLMKKDSGEKKLLHFRLLK,GSEEAKCSITSCTRFGTPSNPAVGSSSRDGEYGDCHSLEHQARSYRSEKTVERRSCFTSGCYE,DLKRQNAVLQAAQDDLGHLRTQLWEAQAEMENIKAIATVSENTKQEAIDEVKRQWREEVASLQAVMK

Amino Acids from 3' Exons

RIRGKMQYYKLHKMIWDTFEPSCGKLKQRWRILRRLPQSLRTPSKKLMKKDSGEKKLLHFRLLK,GSEEAKCSITSCTRFGTPSNPAVGSSSRDGEYGDCHSLEHQARSYRSEKTVERRSCFTSGCYE,DLKRQNAVLQAAQDDLGHLRTQLWEAQAEMENIKAIATVSENTKQEAIDEVKRQWREEVASLQAVMK