McDonnell Genome Institute

Washington University

CircRNA

chr17|50982523|50995533|-|SPAG9|ENST00000262013.11

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9569

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

9

Peptide

IEVTNGQGENK

Amino Acids from 5' Exons

MGSGICQTITSTLDGLIIPSVALWYMTKSGVAIGTKSMWCSQRPK,WAVGFVKLSPLRPWTASSFHPLHDCGTQSLVWLEQNLCGAAKGHENR,GQWDLSNYHLLDLGRPHHSIRCMTVVHDKVWCGYRNKIYVVQPKAMKIE

Amino Acids from 3' Exons

VTNGQGENKMKNLPVPVYLRPLDEKDTSMK,PMVKVKIRKIYLCLSISDLWMKKIHQ,NQWSRKDEKFTCACLSQTSGKRYINE