McDonnell Genome Institute

Washington University

CircRNA

chr17|50135967|50143718|-|PPP1R9B|ENST00000612501.1

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9975

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

21

Peptide

NSEGLGISIIGMGAGADMGLEK

Amino Acids from 5' Exons

LQSLEQEKGRWRVEKAQLEQSVEENKERMEKLEGYWGEAQSLCQAVDEHLRETQAQYQALERKYSKAKRLIKDYQQ,CRAWSRRRGAGGWRRRSWSRVWRRTRSAWRNWKATGVRPRACARLWTSTCGRLRRSTRPWSASTARPSASSRTTSR,AEPGAGEGALAGGEGAVGAECGGEQGAHGETGRLLGGPEPVPGCGRAPAGDSGAVPGPGAQVQQGQAPHQGLPAE

Amino Acids from 3' Exons

TPRAWASASSAWAPGQTWAWRSWVSSSRPRRVVRPIGMA,LRGPGHQHHRHGRRGRHGPGEAGYLRQDRDGGWCGPSGWQ,SEGLGISIIGMGAGADMGLEKLGIFVKTVTEGGAAHRDG