McDonnell Genome Institute

Washington University

CircRNA

chr17|4955074|4955604|+|ENO3|ENST00000323997.10

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9586

20

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

14

14

Peptide

SSESCIRALSRTILAFNVINGGSHAGNK

Amino Acids from 5' Exons

AFNVINGGSHAGNKLAMQEFMILPVGASSFKEAMRIGAEVYHHLKGVIKAKYGKDATNVGDEGGFAPNILENNE,PSMSTGAPMLETSWPCRSSFCLWEPAPSRKPCALAPRSTTTSRGSSRPSMGRMPPMWVMKVASHPTSWRTMR,LQCDQRGLPCWKQAGHAGVHDSACGSQLLQGSHAHWRRGLPPPQGGHQGQVWEGCHQCGRWLRTQHPGEQ

Amino Acids from 3' Exons

PWSCRRPSRRLVTQTRWSAWMWQHLSSIAMGSTILTSSRLMIPHGTSLGRSSESCIRALSRTIL,PGAAEDGHPGGWLPRQGGDRHGCGSIVLSQWEVRSLQVASRTAHHWGEARRAVELYQELS,LELLKTAIQAAGYPDKVVIGMDVAASEFYRNGKYDLDFKSPDDPARHITGEKLGELYKSFIKNYP