McDonnell Genome Institute

Washington University

CircRNA

chr17|48075005|48077041|-|CBX1|ENST00000225603.8

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9885

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

17

7

Peptide

IIGATDSSGELMFLMKCSVTLYTR

Amino Acids from 5' Exons

SEKPRGFARGLEPERIIGATDSSGELMFLMK,QKSHEALLEVWSRSGLLELQTPVESSCSN,RKATRLCSRFGAGADYWSYRLQWRAHVPDEM

Amino Acids from 3' Exons

QRHPLHQKAGGHYGEKTKQEESGGGARRGGRGICGGKSSRPSSGKGQSGVPPKVEGILR,SVTLYTRKLAGTMGKKQNKKKVEEVLEEEEEEYVVEKVLDRRVVKGKVEYLLKWKGFS,ASPFTPESWRALWGKNKTRRKWRRCKRRKRNMWWKKFSTVEWRAKWSTSSGRDSQ