McDonnell Genome Institute

Washington University

CircRNA

chr17|47827039|47828670|-|MRPL10|ENST00000290208.11

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9984

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

21

3

Peptide

GQASYATPAAETQDPDEGLPQPGR

Amino Acids from 5' Exons

EIGLIRLLRREIAAVFQDNRMIAVCQNVALSAEDKLLMRHQLRKHKILMKVFPNQ,RASSGFSAGRQQFSRTTEPSARMWLVQRTSFLCDTSCGNTRSRSSPT,DRPHQASPPGDSSSFPGQPNDSRLPECGSECRGQASYATPAAETQDPDEGLPQP

Amino Acids from 3' Exons

AGCLPSRLSAMAPRLLPATVVCTFSGRSWLLNISPRNQPSTHHACHLLPAPHR,PAAYPPDCPLWLQGCYPPPSCDALSAAEADGCDIYPPETSHPPIMPAISSQPPTG,RLPTLQTVRYGSKAVTRHRRVMHFQRQKLMAVTEYIPPKPAIHPSCLPSPPSPPQE