top of page

McDonnell Genome Institute

Washington University

CircRNA

chr17|47590716|47605552|+|NPEPPS|ENST00000322157.8

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9664

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

9

Peptide

LGWDPKPGEGMVDSSLVK

Amino Acids from 5' Exons

EWWTHLWLNEGFASWIEYLCVDHCFPEYDIWTQFVSADYTRAQELDALDNSHPIE,NGGLIFGMKVLHPGLNICVTTASQSMIFGLSLFLLITPVPRSLTPITAILL,MVDSSLVKRFCILDISVCRPLLPRVYLDSVCFCLHPCPGARLRQPSY

Amino Acids from 3' Exons

ARAGIISTVEVLKVMEAFVNEPNYTVWSDLSCNLGILSTLLSHTDFYEEIQEFVKDVFSPIGERLGWDPKPGE,LELESLALRFKSWRLLMSPIILYGATAVTWGFSQLSCPTQTSMRKSRSLKMSFHLGRDWAGTPNLEK,SSWNHHCRGSKSHGGFCEAQLYCMERPELPGDSLNSLVPHRLLGNPGVCERCLFTYRGETGLGPQTWR

bottom of page