McDonnell Genome Institute

Washington University

CircRNA

chr17|47326225|47344292|+|EFCAB13|ENST00000331493.6

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9882

13

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

9

Peptide

MQVAESVQR

Amino Acids from 5' Exons

FGEAYAVPDSSSKLRPANFLIISSINYRTIVPFKIYSKRVNSALSTLMIEIL,LERLMRYLIHPANDLPTFSRQITEQLFLSRFIQNVSTLLNALFKKS,WRGLCGTFIQQIKTCQLFDNLVNKLQNNCSFQDLFKTCQLCLIKHFDDLRNL

Amino Acids from 3' Exons

IIPPFLKLSKEKVTRKENSLCKLPNQYSVHKTSSPLCTSSAIT,LSLLFSCQRRRQGKKTLYASCRISTAFTRLHHLFVHLLQLL,YPSFSEAVKGEGDKERKLFMQVAESVQRSQDFITSLYIFCNYS