McDonnell Genome Institute

Washington University

CircRNA

chr17|47156912|47158303|-|CDC27|ENST00000066544.7

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9654

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

14

2

Peptide

SLLGGPAALSPLTPSK

Amino Acids from 5' Exons

ELNRLNLESSNSKYSLNTDSSVSYIDSAVISPDTVPLGTGTSILSKQVQNKPKTGRSLLGGPAALSPLTP,NTDINLPIQSTPIQIPQCLILIQLFHLILSHWEQELPYYLNRFKINQKLVEVYEDQQLLVHPQ,IKQIEFRIFQFKVLLEYRFLSVLYFSCNFTYCPTGNRNFHIITGSKTKNWSKFIRRTSSSSINPK

Amino Acids from 3' Exons

QDRSACQRIRMLPKEPFKSFPLVSLIIMN,KTDRLAKGSECYQKSLSLNPFLWSPFESLCEI,RQIGLPKDQNVTKRALVILSSGLPLNHYVK