McDonnell Genome Institute

Washington University

CircRNA

chr17|47142228|47143982|-|CDC27|ENST00000066544.7

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9741

34

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

4

Peptide

AAAVQHLR

Amino Acids from 5' Exons

ENSKKLKMKFPPKIPNRKTKSKTNKGGITQPNINDSLEITKLDSSIISEGKISTITPQIQAFNLQKAAA,RIAKNKSFHLKSQTEKQKVKLIKEELNLTMIAWKLQNWTLPSFQKGKYPQSHLRFRPLIYKKQQQ,EQKIKNEVSTNPKQKNKKNRRNNSTHKPGNYKIGLFHHFRRENIHNHTSDSGLSTKSSS

Amino Acids from 3' Exons

YNTSGIEPHYYISPKRTASKKFTTLYQLHNQ,TTPQVLSPTITSPPNALPRRSSRLFTSDSSTTK,QHLRYAPLLHLPQTHCLEEVHDSLLVTAPQP