McDonnell Genome Institute

Washington University

CircRNA

chr17|45475099|45475726|-|PLEKHM1|ENST00000430334.7

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.905

8

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

18

Peptide

SLQEHIISELEHLTFVNTDVGR

Amino Acids from 5' Exons

THHLRVGAPDVCQHGCGPLPGMAAAGPERWPDGVLPEAAAAGAGPLAVLPAHRPAPGCGGRVPPLPAGPHVLVLRTLLQVCHLKVDAHPIGPVWALPAFAGPSLYLWCRTTAEGISGFHFPFFRLRHRSPSLGPDTEEPEADCLLPQPGHGQFIPAVLQPKLLLTPREWLQESRPLRGAHVLLRPGHSKCGLRPVSAR,HIISELEHLTFVNTDVGRCRAWLRLALNDGLMECYLKLLLQEQARLHEYYQPTALLRDAEEGEFLLSFLQGLTSLSFELSYKSAILNEWTLTPLALSGLCPLSELDPLSTSGAELQRKESLDSISHSSGSEDIEVHHSGHKIRRNQKLTASSLSLDTASSSQLSCSLNSDSCLLQENGSKSPDHCEEPMSCDSDLGTANAEDSDRSLQ,TSSQSWSTRLSTRMWAAAGHGCGWPTMAWSATSCCCRSRPACMSTTSPPPCSGMLRRASSSLASCRASRPCPSNSPTSLPSMSGRSPHWPCLGFARFLSWTLSLPLVQNYSGRNLWIPFPILQALKTSKSITRAIRYGGTRSLPPPSAWTRPVHPSCPAATLIAAYSKRMAPRVQTIARSPCPVTQTWAQQMLRTQTGLCK

Amino Acids from 3' Exons

THHLRVGAPDVCQHGCGPLPGMAAAGPERWPDGVLPEAAAAGAGPLAVLPAHRPAPGCGGRVPPLPAGPHVLVLRTLLQVCHLKVDAHPIGPVWALPAFAGPSLYLWCRTTAEGISGFHFPFFRLRHRSPSLGPDTEEPEADCLLPQPGHGQFIPAVLQPKLLLTPREWLQESRPLRGAHVLLRPGHSKCGLRPVSAR,HIISELEHLTFVNTDVGRCRAWLRLALNDGLMECYLKLLLQEQARLHEYYQPTALLRDAEEGEFLLSFLQGLTSLSFELSYKSAILNEWTLTPLALSGLCPLSELDPLSTSGAELQRKESLDSISHSSGSEDIEVHHSGHKIRRNQKLTASSLSLDTASSSQLSCSLNSDSCLLQENGSKSPDHCEEPMSCDSDLGTANAEDSDRSLQ,TSSQSWSTRLSTRMWAAAGHGCGWPTMAWSATSCCCRSRPACMSTTSPPPCSGMLRRASSSLASCRASRPCPSNSPTSLPSMSGRSPHWPCLGFARFLSWTLSLPLVQNYSGRNLWIPFPILQALKTSKSITRAIRYGGTRSLPPPSAWTRPVHPSCPAATLIAAYSKRMAPRVQTIARSPCPVTQTWAQQMLRTQTGLCK