top of page

McDonnell Genome Institute

Washington University

CircRNA

chr17|45244175|45245416|+|FMNL1|ENST00000328118.7

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9616

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

13

3

Peptide

TAQQLNAIIAASMSIK

Amino Acids from 5' Exons

QLNAIIAASMSIKSSDKLRQILE,NMPSLQPQCPSSPLTNSARSW,TECHHCSLNVHQVLQTPPDPG

Amino Acids from 3' Exons

CPWTVSWRTCAPCSEASHRESLCGRMTAWCSRSSGPTRPPWTSCWQTARRL,VPGQCPGGRALPAARPRVDTERVCAAGLHGAQGVPEGQLAHHGQAAGRQQDGS,SLDSVLADVRSLQRGLELTQREFVRQDDCMVLKEFLRANSPTMDKLLADSKTAQ

bottom of page