McDonnell Genome Institute

Washington University

CircRNA

chr17|44875933|44881722|-|EFTUD2|ENST00000402521.7

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9601

12

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

11

11

Peptide

HIVDEVNGLISCAILTSSSQSK

Amino Acids from 5' Exons

VMLNTERLIKHAVQERLAVTVCINKIDRLILELKLPPTDAYYKLRHIVDEVNGLI,CTQSGSSMRCRRGWQSLCASTRLTGSWSSCLQLMLITSCATLWMRSMD,DAEHRAADQACGAGEAGSHCVHQQDPADPGAEAASNCLLQAAPHCGGQWINK

Amino Acids from 3' Exons

LCYTDILFTEQE,CAILTSSSQSK,VLYHPLHRAR