McDonnell Genome Institute

Washington University

CircRNA

chr17|44253117|44254662|-|SLC4A1|ENST00000262418.10

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9002

36

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

14

4

Peptide

EQRISGLLVAVLVETLGA

Amino Acids from 5' Exons

ADCQQTAQDGQGLRLPPGPAAGSRHGWGGRPLWDALAQCHHRAFRHPCQRPHCHGQSQHPRGCSPDPGGQRAADQWTPGRCAC,LIVSKPERKMVKGSGFHLDLLLVVGMGGVAALFGMPWLSATTVRSVTHANALTVMGKASTPGAAAQIQEVKEQRISGLLVAVLV,LSANLSARWSRAPASTWTCCWAWVGWPPSLGCPGSVPPPCVPSPMPTPSLSWAKPAPQGLQPRSRRSKSSGSVDSWSLCLW

Amino Acids from 3' Exons

KLSVPDGFKVSNSSARGWVIHPLGLRSEFPIWMMFASALPALLVFILIFLESQIT,NSRCLMASRCPTPQPGAGSSTHWACVPSFPSGCLPPPCLLCWSSSSYSWSLRSP,TLGAWLQGVQLLSPGLGHPPTGLAFRVSHLDDVCLRPACSAGLHPHIPGVSDHH