McDonnell Genome Institute

Washington University

CircRNA

chr17|42987255|42990436|+|RUNDC1|ENST00000361677.5

Cancer

Type of Peptide

BRCA-Luminal B

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9486

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

13

Peptide

QVVDTVSARPVGR

Amino Acids from 5' Exons

SEQEKQERLETQREKQKELILQLKTQLDDLETFAYQEGSYDSLPQSVVLERQR,VSRKSKSVWKPKGRSRKNYCSSRPSMTWKRLPIKRAVMTRCHSPWCWKDS,AGKARASGNPKGEAERTDTAAQDPARPGNVCLSRGQLLAATVRGVGKTA

Amino Acids from 3' Exons

MKWEAPCRQVVDTVSARPVGRQEMAAAEQAAAERLQETAK,SGKPLADRWWTLVQGRWEDRKWLQQNRQQQNASRKQQ,EVGSPLQTGGGHCECKAGGKTGNGCSRTGSSRTPPGNSK