McDonnell Genome Institute

Washington University

CircRNA

chr17|42818220|42819609|-|BECN1|ENST00000543382.6

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9599

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

24

Peptide

MVSLADSSPQPGAYYFSAPIPCQR

Amino Acids from 5' Exons

TLFGDLRANEGQTVTDGAKGAGTRGGEADPGAGRRGKEPQDSGRKSREGPGGETGSGGSS,RCLEILEQMNEDDSEQLQMELKELALEEERLIQELEDVEKNRKIVAENLEKVQAEAERLDQEEA,AVWRSSKMRMTVNSYRWSRSWHRRRGSRSWKTWKRTARWQKISRRSRLRLRDWIRRKL

Amino Acids from 3' Exons

EPFIETPRQDGVSRRFIPPARCLLLLSPHSLPKASRILIKSRNRDLEPGDRDASSPSLLALSEKMYSLIPGPSPSSMDFFLLFTEWERIVALMMKYKKLRELTNHQEMGSEVSNQMLLDVQVLSSHCCRRACWQGVYFLKWPFLVLPSFPLTYEFFMLPLPPSTKANLHAECPCGRPAWPSFGREVPLGGQSGEWVCSLRPLSWCLRVSATGIVVGGGSLSVPSCGPWAGGCLQDDVHRKCQQLHSDWGGIWRHHGEPQPKTE,SHLLKLLARMVSLADSSPQPGAYYFSAPIPCQRLVEFLNPGIETWSQVIEMHHHLAFWPFQKRCIPLYLARHLPVWIFSCSCSQSGKGLSIEKNGSDPITKRWALEKFQTSKCCMFRSLVLIAAGKELAGKGYNIFNGLSWFSLLFHCRHMNFLCSLSLLSPPRPTFMLSVPVEDQHGLPLGERYPWEVSRARSGYVPGPSAGAESLPLALVEEASLFPHVARGRGAVCRMMSTESANSFTLIGEASDGGTMENLSRRLK,AIYNSSPGWCLSQIHPPSQVPTTSQPPFLAKGNFNIQESRPGARRCIITPFGPFRKDVFPYTWPVTFQYGFFPVAVHRVGKDSSFNDEVLKKIEGVIDQSPRDGLLRSFKLANVVRCSGPFSLLQVKSLLARGIIFSKMAFPGSPFFSTVDIIFYAPSPSLVHQGQPSCVSLWKTSMAFLWERGTLGRSVGLGVGMFLEAPQLVLESLCHWHCSRWRKPLCSLMWPVGGGLSAGCPQKVPTASLLGRHLMAAPWRTSAED