McDonnell Genome Institute

Washington University

CircRNA

chr17|4242255|4242448|-|ANKFY1|ENST00000341657.8

Cancer

Type of Peptide

BRCA-Luminal A

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.997

25

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

8

Peptide

SAALSWLR

Amino Acids from 5' Exons

RRWPSWRSTCFCGRSMSSCRRSWRRQRSAALSWLRRQTRRAAASPSSAVCWPSWQTSTSRSST,GGGQVGEALDASAAGVCQAAEEAGGDREALRSLGCAGKQGEQQRVLHQPSAGHRGRPLRAGAVQ,EVAKLEKHLMLLRQEYVKLQKKLAETEKRCALLAAQANKESSSESFISRLLAIVADLYEQEQY

Amino Acids from 3' Exons

RRWPSWRSTCFCGRSMSSCRRSWRRQRSAALSWLRRQTRRAAASPSSAVCWPSWQTSTSRSST,GGGQVGEALDASAAGVCQAAEEAGGDREALRSLGCAGKQGEQQRVLHQPSAGHRGRPLRAGAVQ,EVAKLEKHLMLLRQEYVKLQKKLAETEKRCALLAAQANKESSSESFISRLLAIVADLYEQEQY