McDonnell Genome Institute

Washington University

CircRNA

chr17|42337434|42346713|-|STAT3|ENST00000264657.9

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9696

13

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

6

Peptide

LENWAYAASK

Amino Acids from 5' Exons

SIVSELAGLLSAMEYVQKTLTDEELADWKRRQQIACIGGPPNICLDRLEN,ASVSWRGFCQRWSTCRKLSRTRSWLTGRGGNRLPALEARPTSAIGKT,HREAGGAFVSDGVRAENSHGRGAGLEEAATDCLHWRPAQHLPRSARKL

Amino Acids from 3' Exons

GICGQQRITCHFGVSSPGRDPAVPLPARVECSLSAQSTKNQAVSS,AYAASKESHATLVFHNLLGEIDQQYSRFLQESNVLYQHNLRRIKQFLQ,HMRPAKNHMPLWCFIISWERLTSSIAASCKSRMFSISTIYEESSSFF