McDonnell Genome Institute

Washington University

CircRNA

chr17|42322284|42323354|-|STAT3|ENST00000404395.3

Cancer

Type of Peptide

BRCA-Luminal A

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

6

Peptide

LTQENMAGK

Amino Acids from 5' Exons

VRPRSSPWNHTQSSSTTCHLLKSSWAIRSWMLPISWCLHWSISILTFPRRRHSESIVGQRARSILKLTQ,DPDPVRGTIHKAAAEQHVICNHHGLDHGCYQYPGVSTGLSLSHSQGGGIRKVLSAREPGASSP,KTQIQSVEPYTKQQLNNMSFAEIIMGYKIMDATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHPEADP

Amino Acids from 3' Exons

ENMAGKGFSFWVWLDNIIDLVKKYILALWNE,KTWLARASPSGSGWTISLTLKSTSWPFGTK,KHGWQGLLLLGLAGQYHPCEKVHPGPLERR