McDonnell Genome Institute

Washington University

CircRNA

chr17|42120224|42130590|-|CTD-2132N18.3|ENST00000592574.1

Cancer

Type of Peptide

PRAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9251

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

26

Peptide

SPSPLSASLHSTSPHPHALWTTTAGR

Amino Acids from 5' Exons

LTTYPTWRMCQRMRTDCWGWWWMWRISSCLFTRKRTQTPSRSISTSS,PRIPLGECVRGDKPTAGDGGGCGESLHVCSQGRGHRHQAGLFLPLQ,DHVSHLENVSEDEINRLLGMVVDVENLFMSVHKEEDTDTKQVYFYLFK

Amino Acids from 3' Exons

LEVPLPTKCLFAHQSPPARSLDHYSWTGNGGSGRRSTTQWTSCWEQDLSIAGSAGGVCGRQIQPRPPLCQGTVSRVPGEHNW,WRSPSPLSASLHSTSPHPHALWTTTAGRAMAGRGGAARPNGPAAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIG,GGPPPHVPLCIAPVPTRTLSGPLQLDGQWRVGEAQHDPMDQLLGTRSVNLSWFCWGSLRANPASSSALSRDSFTSTRRAQLE