McDonnell Genome Institute

Washington University

CircRNA

chr17|41755729|41771862|-|JUP|ENST00000310706.9

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9975

12

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

12

3

Peptide

PPTAPCTPAMCPLTR

Amino Acids from 5' Exons

TWMPPTAPCTPAMCPLTRWRCTWTWMETTPSTPTATASGPRTPLQTTCWPRRPGP,HGCHLPPHVLQRCAPPAGDAHGHGWRLPHRHLQRRPQAPVPHCRPHAGLGGLAP,MDATYRPMYSSDVPLDPLEMHMDMDGDYPIDTYSDGLRPPYPTADHMLAAAWP

Amino Acids from 3' Exons

PRWRTWSSLSRLSGSRHTPTTRVSTRAPTPACPPSAARASWRRMRPAGASTRSRKPPLTPRGCPPAK,SHDGGDEPDGAAYQGDVAADIHLRLGYPLGRQHLRALRQQQGHHGGGGLRAPVHAQENHHLHPGGAPQP,ATMEVMNLMEQPIKVTEWQQTYTYDSGIHSGANTCVPSVSSKGIMEEDEACGRQYTLKKTTTYTQGVPPSQ