McDonnell Genome Institute

Washington University

CircRNA

chr17|4169197|4242448|-|ANKFY1|ENST00000341657.8

Cancer

Type of Peptide

OSCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9748

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

16

4

Peptide

MSALPGSESPLANTTEEVAK

Amino Acids from 5' Exons

ICCPRSLRGVTAPTAMSALPGSESPLANTT,YAVQGASVVRLLLLVHCQVRSHHSQTPL,MLSKEPPWCDGSYCYECTARFGVTTRKHH

Amino Acids from 3' Exons

RRWPSWRSTCFCGRSMSSCRRSWRRQRSAALSWLRRQTRRAAASPSSAVCWPSWQTSTSRSST,GGGQVGEALDASAAGVCQAAEEAGGDREALRSLGCAGKQGEQQRVLHQPSAGHRGRPLRAGAVQ,EVAKLEKHLMLLRQEYVKLQKKLAETEKRCALLAAQANKESSSESFISRLLAIVADLYEQEQY