McDonnell Genome Institute

Washington University

CircRNA

chr17|41524142|41525273|-|KRT19|ENST00000361566.7

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9984

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

15

19

Peptide

TLQGLEIELQSQLSMILGATIENSRIVLQIDNAR

Amino Acids from 5' Exons

TEELNREVAGHTEQLQMSRSEVTDLRRTLQGLEIELQSQLSM,LKNTGRSLATRSSSRAGPRLLTCGAPFRVLRLSCSHSA,RIEPGGRWPHGAAPDEQVRGYPAAHPSGSDAAVTAEH

Amino Acids from 3' Exons

ILGATIENSRIVLQIDNARLAADDFRT,FLVPPLRTPGLSCRSTMPVWLQMTSEP,SWCHHELQDCPADRQCPSGCRLPNQ