McDonnell Genome Institute

Washington University

CircRNA

chr17|40400849|40408124|-|TOP2A|ENST00000423485.5

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9234

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

11

9

Peptide

RLMDGEEPLPMGAETPLSVR

Amino Acids from 5' Exons

LFGSIVISTKRSHVEVFIQPACAMVHSYYSHGADKWCRNRYWVVLQNPQLCANCKHQAFDGWRRTFAN,SLARLLFPPKDDHTLKFLYDDNQRVEPEWYIPIIPMVLINGAEGIGTGWSCKIPNFDVREIVNNIRRLMDGEEPLPM,LWLDCYFHQKMITRSFYMMTTSVLSLNGTFLLFPWCMVLKESVLGGPAKSPTLMCVKLITSGVWMEKNLCQ

Amino Acids from 3' Exons

GAETPLSVRLSLREIQPKLWLFQALVWLGETNMGFSLLEEKYSMFEKLLIS,GPKLHVYAYPDGRFSQNFGCFRPWCGWERQIWGFPSRKNTQCSRSFSA,GRNSTECTLILTEGDSAKTLAVSGLGVVGRDKYGVFPLRGKILNVREASHKQ