McDonnell Genome Institute

Washington University

CircRNA

chr17|40028825|40033206|-|MED24|ENST00000356271.7

Cancer

Type of Peptide

OSCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9894

9

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

14

Peptide

KFINIPTMLSVHAEQMHK

Amino Acids from 5' Exons

TMDADHSKSPEGLLGVLGHMLSGKSLDLLLAAAAATGKLKSFARKFI,RWMQTTLSHRRDCWESWATCCPGRVWTCCWLPPPPLESNPSPGNSS,DGCRPLVTGGTAGSPGPHAVREESGLAAGCRRRHWKAEILRPEIHQ

Amino Acids from 3' Exons

HPHDAVCACGADAQDRLPHCPRRDPARGHHEPDRRDAVPGGAADDGEAHA,IPTMLSVHAEQMHKTGFPTVHAVILLEGTMNLTGETQSLVEQLTMVKRMQ,SPRCCLCMRSRCTRPASPLSTPSCSRAPTQARRSPWWSSRWSAC