McDonnell Genome Institute

Washington University

CircRNA

chr17|39706989|39717480|+|ERBB2|ENST00000269571.9

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.948

8

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

13

Peptide

RAHASLAPSTAPTLCTGTDMK

Amino Acids from 5' Exons

CAPAQTSCGSLPVPRPTWTCSATSTRAARWCRETWNSPTCPPMPACPSC,VHRHRHEAAAPCQSRDPPGHAPPPLPGLPGGAGKPGTHLPAHQCQPVLPA,CTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQ

Amino Acids from 3' Exons

EADQCVACAHYKDPPFCVARCPSGVKPDLSYMPIWKFPDEEGACQPCPINCTH,RLTSVWPVPTIRTLPSAWPAAPAVNLTSPTCPSGSFQMRRAHASLAPSTAPT,GPVCGLCPLGPSLLRGPLPQRCETPLLHAHLEVSRGGRMPALPHQLHPL