McDonnell Genome Institute

Washington University

CircRNA

chr17|3951250|3951685|-|ATP2A3|ENST00000309890.11

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9884

25

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

12

5

Peptide

DIVPGDIVEVAGPGLVR

Amino Acids from 5' Exons

ERNAESAIEALKEYEPEMGKVIRSDRKGVQRIRARDIVPGDIVEVA,NATPRVPSRPRSMSLRWARSARTARACRGSVPGTSSQGTLKWQ,TQRRECHRGPEGVADGQGDPLGPQGRAEDPCPGHRPRGHCRSG

Amino Acids from 3' Exons

VLAWFEEGEETTTAFVEPLVIMLILVANAIVGVWQ,SWPGSRRARRPRPPSWSPWSSCSSWPTPLWACG,PGLVRGGRGDHDRLRGAPGHHADPRGQRHCGRVA