McDonnell Genome Institute

Washington University

CircRNA

chr17|39490556|39511630|+|CDK12|ENST00000430627.6

Cancer

Type of Peptide

BRCA-Luminal B

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9614

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

10

Peptide

YTPAIDVWSCGPK

Amino Acids from 5' Exons

SKRNSSFKTCEEREGTEDTSLTHRPSSPSRAPWWRSVSPRLSRTKGNHTTSATIKETK,PKETLPSKPVKKEKEQRTRHLLTDLPLPPELPGGDLSPPDSPEPKAITPPQQPYKKRP,QKKLFLQNLRKRRNRGHVTYSQTFLSLQSSLVEICLPQTLQNQRQSHHLSNHIKRDQ

Amino Acids from 3' Exons

SPLHKQSHYFVVPTSRTTARRGTLHTSHRCLELW,RPYTNKVITLWYRPPELLLGEERYTPAIDVWSC,ALTQTKSLLCGTDLQNYCERNVTHQPMFGAV