McDonnell Genome Institute

Washington University

CircRNA

chr17|37632112|37639568|-|DDX52|ENST00000620209.4

Cancer

Type of Peptide

BRCA-Luminal A

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9668

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

25

2

Peptide

LLQNILDAGFQMPTPIQMQAIPVMLHR

Amino Acids from 5' Exons

INFLRNKHKIHVQGTDLPDPIATFQQLDQEYKINSRLLQNILDAGFQMPTPIQMQAIPVMLH,TSCGINTKFTSKEPIFLTQLLHFSNLTRNIKSILDYFRTFMQVSKCLRQSKCKPSQLCC,KLLAETQNSRPRNRSSPNCYISATPGINQFSTTSEHSRCRFPNAYANPNASHPSYAA

Amino Acids from 3' Exons

RQGFTMLASMVSISPRDSPTLGSQSAGITDVSHHAQP,DRVSPCPVWSRSPDLVIHPPWAPKVLGLQMATTPSQ,TGFHHVSQYGLDLLTSFTHLGLPKCWDYRCEPPRPA