McDonnell Genome Institute

Washington University

CircRNA

chr17|37538323|37571987|-|SYNRG|ENST00000612223.4

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9667

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

3

Peptide

EYLLDAYK

Amino Acids from 5' Exons

VIKKANDTLNGISSSSVCTEVIQSAQGMEYLL,SLRRQMIPMESVVVLFAQKFSQLKAWNIY,HEGKYLKWNQFCLHRSNSVSSRHGIFI

Amino Acids from 3' Exons

MPIRKSKPQLQLEILPNCIPFCHLGFPGKLLDRYGPLIELHLANLQKKNFIPFPRH,CLENLRNHNDSNWNRYCQTVSHSDVIWASQGNSWTDMGLSSNYTWQTYKRRTLYRSSHDSGNT,AYKKILETTMTPTGIDTAKLYPILMSSGLPRETLGQIWALANRTTPGKLTKEELYTVLAMIAVTQ