McDonnell Genome Institute

Washington University

CircRNA

chr17|37538323|37542430|-|SYNRG|ENST00000614941.4

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9813

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

13

Peptide

EYLLAGSGSPSATSILQK

Amino Acids from 5' Exons

VIKKANDTLNGISSSSVCTEVIQSAQGMEYLL,SLRRQMIPMESVVVLFAQKFSQLKAWNIY,HEGKYLKWNQFCLHRSNSVSSRHGIFI

Amino Acids from 3' Exons

QEVDPPQPPQFFKRKRLHLAVLKTSPHLSPKRPLVKMLFQRPPSQLLPVLKTRFLRPVSKRNMKTETIKISQNRTCLRLNGARRPRVPAQRPVVPLKKPRTNVRMTLESFKVKSPKSANLTSPLHKAKNPVKKSKVSWQPLTFLFK,RKWIPLSHLNSSKERDFIWQFKHHHDISLQSNDLCKRCSSRDHLPSSCQFRHDSSDQAKGIKQRLRFHKTGPAYGTEPGGHVSQPSVQWCLSRNPERMFGLWRVSKKAQNQQILLSSHFTKQNEIQRNDQKAGNLPFCS,GSGSPSATSILQKKETSFGSSENITMTSLSKVTTFVSEDALPETTFPALASFKDTIPQTSEQKEYENRDYKDFTKQDLPTAERSQEATCPSPASSGASQETPNECSDDFGEFQSEKPKISKFDFLVATSQSKMKSSEEMIKSELATFDLSVQ