McDonnell Genome Institute

Washington University

CircRNA

chr17|37263684|37284970|-|ACACA|ENST00000612895.4

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9768

16

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

17

2

Peptide

AMLSLCLVVIALYNAGIRR

Amino Acids from 5' Exons

VQAEVPGSPIFVMRLAKQSRHLEVQILADQYGNAISLFGRDCSVQRRHQKIIEEAPATIATPAVFEHMEQ,FKLKFLDLPYLDPNNLVIWRCRSRTNMAMLSLCLVVIALYNAGIRRLLKKHLLLLLLQQYLNTWN,SSSSWISHICDETSQTISSSGGADLSGPIWQCYLFVWSLLCTTQASEDYRSTCYYCYSSSITHGT

Amino Acids from 3' Exons

VQHVWLAPSKAGPRQKENRFSTRFHCGFSSRICYSLWGKSDE,SSMSGLHLVKQGRDRKKIDSQRDFTVASPAEFVTRFGGNKVIEK,PACLACTSRAETERKILNEISLWLLQQNLLLALGEIKLR