McDonnell Genome Institute

Washington University

CircRNA

chr17|37179259|37181356|-|ACACA|ENST00000612895.4

Cancer

Type of Peptide

PRAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9362

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

9

Peptide

LPGGNEIMFQAYGDK

Amino Acids from 5' Exons

SLIKLWESMSTQAFLPSPPLPSDMLTYTELVLDDQGQLVHMNRLPGGNE,PSNSGSLCPLKHFFHLPLCLLTCLTLNWYWMIKVSWSTTGFQEEM,PDQTLGVYVHSSISSISPSAFHADLHTGTGSRSAGPHEQASRRK

Amino Acids from 3' Exons

IMFQAYGDKQGPLHGMLINTPYVTKDLLQSKRFQAQSLGTTYIYDIPEMFRQ,SCFRHMETNRDHCMECSILHMPKTCCNQRGSRHNPGQHTYMISQRCFG,HVSGIWRQTGTTAWNVNQYSICDQRPAAIKEVPGTILRDNIHIYPRDVSA