McDonnell Genome Institute

Washington University

CircRNA

chr17|36581343|36587245|+|GGNBP2|ENST00000613102.4

Cancer

Type of Peptide

BRCA-HER2-enriched

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9206

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

6

Peptide

SLVELLMTVEK

Amino Acids from 5' Exons

MTVEKVQGISRLEQLCEEFSEEERVRELKQEKKRQKRKNRRKNKCVCDIPTPLQTADEKEVSQEK,PWKKYRVLADWNNFVRNFQKRNEENSSKKRNAKNGRIDEKISVCVIFLLPYKQQMKRKAKR,DRGKSTGYQIGTTLGIFRRGTSKRTQARKETPKTEETKKVCVYSYSLTNSRKGSKPRE

Amino Acids from 3' Exons

IQKLGSCITDPGNRETSGNTMHTVFHRDKTKDTHPESCCSSEKGGQPLPWFEHRKNVPQFAEPTETLFGPDSGKGAKSLVELL,SRSLEAVLQIQVIERPQEIPCTQCFTVTRPKIHILKAVAALKRVGSHCLGLSIGKMYHSLQNLQKRCLVPIPEKVPRALNS,PEAWKLYYRSRSRDLRKYHAHSVSPQDQRYTSKLLQLKGWAAIALVAEKCTTVCRTYRNVVWSRFRKRCQELSTP