McDonnell Genome Institute

Washington University

CircRNA

chr17|36545618|36560871|+|GGNBP2|ENST00000613102.4

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9711

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

3

Peptide

TFGAGAGR

Amino Acids from 5' Exons

AGAGRRRQRRRQKQQRRRRRQLGGGGDGGNGSVGDDGATRGSVQGRGGGVPLREEADSPLHRRHPD,QELGGGGSGGGRNSSGGGGGSWEEVVTVATAASGTMARLVAVCRDGEEEFPFERRQIPLYIDDTLT,RSWEEAAAAAAETAAAAAAAAGRRWRWQRQRRGRWRDSWQCAGTGRRSSPSRGGRFPSTTTP

Amino Acids from 3' Exons

VQTKHDRCYSKKEEEMSVALLRYAQAKTFG,SKLNDMIDAIPKSKKNKRCQLHSLDTHKPKPL,PNMTMLFQKVRRIRDVSCTPIRTSQNLW