McDonnell Genome Institute

Washington University

CircRNA

chr17|3590963|3591353|-|TRPV1|ENST00000574085.5

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9577

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

11

Peptide

LSAESHAQPAR

Amino Acids from 5' Exons

AAVPGLCRRQHREDPQALSQEYLSRCSELPGSGEPAALPAEEQEAPHRQRVQRWPQRWARGGPQPWPALTLPYVFQTLRQGRPVCKPCSTCTTDRTPPSPCSWRSRGKRTARSLSTPATRTATTR,LLSQDSVAASTEKTLRLYDRRSIFEAVAQNNCQDLESLLLFLQKSKKHLTDNEFKGGPSAGLGEGPSPGLPPSLMSFRPDREDLSAESHAQPARRTEHHHPPAPGDRAANGQPEGACQRQLHGQLLQ,CCPRTLSPPAPRRPSGSMIAGVSLKPLLRITARIWRACCSSCRRARSTSQTTSSKVAPALGSGRAPALACPDPPLCLSDPETGKTCLLKAMLNLHDGQNTTIPLLLEIARQTDSLKELVNASYTDSYYK

Amino Acids from 3' Exons

AAVPGLCRRQHREDPQALSQEYLSRCSELPGSGEPAALPAEEQEAPHRQRVQRWPQRWARGGPQPWPALTLPYVFQTLRQGRPVCKPCSTCTTDRTPPSPCSWRSRGKRTARSLSTPATRTATTR,LLSQDSVAASTEKTLRLYDRRSIFEAVAQNNCQDLESLLLFLQKSKKHLTDNEFKGGPSAGLGEGPSPGLPPSLMSFRPDREDLSAESHAQPARRTEHHHPPAPGDRAANGQPEGACQRQLHGQLLQ,CCPRTLSPPAPRRPSGSMIAGVSLKPLLRITARIWRACCSSCRRARSTSQTTSSKVAPALGSGRAPALACPDPPLCLSDPETGKTCLLKAMLNLHDGQNTTIPLLLEIARQTDSLKELVNASYTDSYYK