McDonnell Genome Institute

Washington University

CircRNA

chr17|35624396|35682824|+|AP2B1|ENST00000610402.4

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

8

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

31

8

Peptide

MEPLNNLQVVANAVAALSEISESHPNSNLLDLNPQNINK

Amino Acids from 5' Exons

VVANAVAALSEISESHPNSNLLDLNPQNINKLLTALNECTEWGQIFILDCLSNYNPKDDREAQ,WWLMPRHYLKSVSLTQTATYLITHRTLISCQPMNALNGARFSSWTACLITTLKMIGRLR,GGCRSGIINQVSPKQQLTSEPTEHAADSPEMHMGPDFHPGLPVLQPRSGGSE

Amino Acids from 3' Exons

LWCHPQHSSGHPYTTDAKPEHCLPASQYLGPSHEDGTSEPP,FGVIPSTPLAIHTPLMPNQSIDVSLPLNTLGPVMKMEPLNNLQ,LVSSPALLWPSIHHCQTRALMSPCLSIPWAQSRWNLITS