McDonnell Genome Institute

Washington University

CircRNA

chr17|35605704|35608387|+|AP2B1|ENST00000610402.4

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9968

53

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

9

Peptide

DLIADSNPMFSLSRR

Amino Acids from 5' Exons

FSLSRRSELYADQSGTKEACVSLLDELRQESARHGHHGCKQLCE,SLFPDVVNCMQTDNLELKKLVYLYLMNYAKSQPDMAIMAVNSFVK,LSFQTTVCRLTIWNRSLCISTTTPRVSQTWPSWLTAL

Amino Acids from 3' Exons

DCEDPNPLIRALAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKTAAVCVAKLHDINAQMVEDQGFLDSLRDLIADSNPM,TVKILILFEPWQSEPWGASGTKLQNISVSRSASARMRIPMFGKQQQSAWQNSMISMPKWWKIRDFWILYGISQIQIQ,LRSSFDSSLGSQNHGVHPGRQNYRISLAAPQVLEGGSLCSENSSSLRGKTPYQCPNGGRSGISGFSTGSHSRFKSN