McDonnell Genome Institute

Washington University

CircRNA

chr17|32755491|32780784|-|MYO1D|ENST00000318217.9

Cancer

Type of Peptide

BRCA-Luminal A

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9301

14

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

16

3

Peptide

HLTVNWANTPIFPAERFEK

Amino Acids from 5' Exons

IDYFNNQIIVDLVEQQHKGIIAILDDACMNVGKVTDEMFLEALNSKLGKHAHFSSRK,LTTSTIRSLLTSWSNSTKGSLQSLMMLAMSAKSPMKCFLKHLTVNWANTPIFPAE,LLQQSDHCPRGATAQRDHCNPCLHECRQSHRNVSSTQIGQTRPFFQPK

Amino Acids from 3' Exons

IKRAHLYVHWRSRRFCEPLQVVEHLWKRHNAVRPAVETASPFCYCGCCLQGYEEAIKRHLYCDI,FEKGRIYTFIGEVVVSVNPYKLLNIYGRDTIEQYKGRELYERPPHLFAIADAAYKAMKRRSKDTCIVIS,LKKGASIRSLEKSSFLTLTSCTSMEETQLSSIKAVSCMRDRLTFLLLRMLLTRLRGDQKTLVLYQ