McDonnell Genome Institute

Washington University

CircRNA

chr17|32446944|32469193|+|PSMD11|ENST00000261712.7

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9331

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

9

Peptide

LQATLDMQSVK

Amino Acids from 5' Exons

SVTFRKTMKRQCKSKSRASWNWDLSWQRLDKLQ,EAHSGKRRGSASQRAEHPGTGISPGKDWTSC,KRDIQENDEEAVQVKEQSILELGSLLAKTGQAA

Amino Acids from 3' Exons

VLSCCGSKRWTTKLFWWKYSFKAKHTMPATCRKPELPLLLEPQQMPSTAPLNCRPPWTCSR,FSAAAGVEKDGRQSSFGGSTAFRKQNIPCPEQPAESPSCLNFCSNHSKCHLLPPIAGHLGHAV,SQLLRELKKMDDKALLVEVQLLESKTYHALSNLPKARAALTSARTTANAIYCPPKLQATLDMQS